PAK2 Antibody (1E1)

Images

 
Western Blot: PAK2 Antibody (1E1) [H00005062-M01] - PAK2 monoclonal antibody (M01), clone 1E1. Analysis of PAK2 expression in human liver.
Proximity Ligation Assay: PAK2 Antibody (1E1) [H00005062-M01] - Analysis of protein-protein interactions between CASP3 and PAK2. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-PAK2 ...read more
Sandwich ELISA: PAK2 Antibody (1E1) [H00005062-M01] - Detection limit for recombinant GST tagged PAK2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, S-ELISA
Clone
1E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PAK2 Antibody (1E1) Summary

Immunogen
PAK2 (NP_002568, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE
Specificity
p21 (CDKN1A)-activated kinase 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAK2 Antibody (1E1)

  • EC 2.7.11
  • gamma-PAK
  • p21 (CDKN1A)-activated kinase 2
  • p21 protein (Cdc42/Rac)-activated kinase 2
  • p21-activated kinase 2
  • p58
  • PAK2
  • PAK-2
  • PAK65
  • PAK65EC 2.7.11.1
  • PAKgamma
  • S6/H4 Kinase
  • serine/threonine-protein kinase PAK 2

Background

The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-68888
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00005058-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF6897
Species: Hu, Mu
Applications: IHC, WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00005062-M01
Species: Hu
Applications: WB, ELISA, PLA, S-ELISA

Publications for PAK2 Antibody (H00005062-M01) (0)

There are no publications for PAK2 Antibody (H00005062-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAK2 Antibody (H00005062-M01) (0)

There are no reviews for PAK2 Antibody (H00005062-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAK2 Antibody (H00005062-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAK2 Products

Bioinformatics Tool for PAK2 Antibody (H00005062-M01)

Discover related pathways, diseases and genes to PAK2 Antibody (H00005062-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAK2 Antibody (H00005062-M01)

Discover more about diseases related to PAK2 Antibody (H00005062-M01).
 

Pathways for PAK2 Antibody (H00005062-M01)

View related products by pathway.

PTMs for PAK2 Antibody (H00005062-M01)

Learn more about PTMs related to PAK2 Antibody (H00005062-M01).
 

Research Areas for PAK2 Antibody (H00005062-M01)

Find related products by research area.

Blogs on PAK2

There are no specific blogs for PAK2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAK2 Antibody (1E1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAK2
Entrez
OMIM
Uniprot