PAK1 interacting protein 1 Recombinant Protein Antigen

Images

 
There are currently no images for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PAK1 interacting protein 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAK1 interacting protein 1.

Source: E.coli

Amino Acid Sequence: GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAK1IP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68615. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAK1 interacting protein 1 Recombinant Protein Antigen

  • bA421M1.5
  • FLJ20624
  • hPIP1WD repeat-containing protein 84
  • MAK11
  • p21-activated protein kinase-interacting protein 1
  • PAK1 interacting protein 1
  • PIP1PAK/PLC-interacting protein 1
  • RP11-421M1.5
  • WDR84PAK1-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1522
Species: Hu, Mu
Applications: WB, GS, IB, ICC/IF, IHC
NB100-56506
Species: Hu, Mu, Rt, De, Ma
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02269
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-176
Species: Hu
Applications: WB
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-04611
Species: Hu
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58661
Species: Hu
Applications: IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
H00030851-M01
Species: Hu
Applications: WB, Simple Western, ELISA, S-ELISA
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP) (0)

There are no publications for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP) (0)

There are no reviews for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PAK1 interacting protein 1 Products

Bioinformatics Tool for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP)

Discover related pathways, diseases and genes to PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP)

Discover more about diseases related to PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP).
 

Pathways for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP)

View related products by pathway.

PTMs for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP)

Learn more about PTMs related to PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP).

Blogs on PAK1 interacting protein 1

There are no specific blogs for PAK1 interacting protein 1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PAK1 interacting protein 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PAK1IP1
Novus 100% Guarantee