PAGE4 Antibody


Western Blot: PAGE4 Antibody [NBP1-57080] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PAGE4 Antibody Summary

Synthetic peptides corresponding to PAGE4 (P antigen family, member 4 (prostate associated)) The peptide sequence was selected from the middle region of PAGE4. Peptide sequence PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PAGE4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAGE4 Antibody

  • CT16.7
  • G antigen family C member 1
  • G antigen, family C, 1
  • JM-27
  • P antigen family, member 4 (prostate associated)
  • PAGE-1
  • PAGE-4FLJ35184
  • Prostate-associated gene 4 protein
  • prostate-associated gene protein 4


This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for PAGE4 Antibody (NBP1-57080) (0)

There are no publications for PAGE4 Antibody (NBP1-57080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAGE4 Antibody (NBP1-57080) (0)

There are no reviews for PAGE4 Antibody (NBP1-57080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAGE4 Antibody (NBP1-57080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PAGE4 Products

Bioinformatics Tool for PAGE4 Antibody (NBP1-57080)

Discover related pathways, diseases and genes to PAGE4 Antibody (NBP1-57080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAGE4 Antibody (NBP1-57080)

Discover more about diseases related to PAGE4 Antibody (NBP1-57080).

Pathways for PAGE4 Antibody (NBP1-57080)

View related products by pathway.

PTMs for PAGE4 Antibody (NBP1-57080)

Learn more about PTMs related to PAGE4 Antibody (NBP1-57080).

Research Areas for PAGE4 Antibody (NBP1-57080)

Find related products by research area.

Blogs on PAGE4

There are no specific blogs for PAGE4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAGE4 Antibody and receive a gift card or discount.


Gene Symbol PAGE4