PAGE4 Antibody

Images

 
Western Blot: PAGE4 Antibody [NBP1-57080] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAGE4 Antibody Summary

Immunogen
Synthetic peptides corresponding to PAGE4 (P antigen family, member 4 (prostate associated)) The peptide sequence was selected from the middle region of PAGE4. Peptide sequence PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAGE4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PAGE4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAGE4 Antibody

  • CT16.7
  • G antigen family C member 1
  • G antigen, family C, 1
  • GAGEC1GAGE-9
  • JM-27
  • P antigen family, member 4 (prostate associated)
  • PAGE-1
  • PAGE-4FLJ35184
  • Prostate-associated gene 4 protein
  • prostate-associated gene protein 4

Background

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for PAGE4 Antibody (NBP1-57080) (0)

There are no publications for PAGE4 Antibody (NBP1-57080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAGE4 Antibody (NBP1-57080) (0)

There are no reviews for PAGE4 Antibody (NBP1-57080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAGE4 Antibody (NBP1-57080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAGE4 Products

Bioinformatics Tool for PAGE4 Antibody (NBP1-57080)

Discover related pathways, diseases and genes to PAGE4 Antibody (NBP1-57080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAGE4 Antibody (NBP1-57080)

Discover more about diseases related to PAGE4 Antibody (NBP1-57080).
 

Pathways for PAGE4 Antibody (NBP1-57080)

View related products by pathway.

PTMs for PAGE4 Antibody (NBP1-57080)

Learn more about PTMs related to PAGE4 Antibody (NBP1-57080).
 

Research Areas for PAGE4 Antibody (NBP1-57080)

Find related products by research area.

Blogs on PAGE4

There are no specific blogs for PAGE4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAGE4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAGE4
Uniprot