Recombinant Human INSL4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human INSL4 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 26 - 139 of Human INSL4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
INSL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human INSL4 GST (N-Term) Protein

  • early placenta insulin-like peptide
  • EPIL
  • EPILearly placenta insulin-like peptide (EPIL)
  • INSL4
  • insulin-like 4 (placenta)
  • Insulin-like peptide 4
  • Placentin

Background

INSL4( AAH26254, 26 a.a. - 140 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80834
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-86343
Species: Hu
Applications: IHC, IHC-P, WB
H00059350-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
AF3107
Species: Hu
Applications: IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
DRL200
Species: Hu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
NLS4753
Species: Dr, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
292-G2
Species: Hu
Applications: BA
H00006018-M05
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-91816
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003641-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for INSL4 Recombinant Protein (H00003641-P01) (0)

There are no publications for INSL4 Recombinant Protein (H00003641-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSL4 Recombinant Protein (H00003641-P01) (0)

There are no reviews for INSL4 Recombinant Protein (H00003641-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSL4 Recombinant Protein (H00003641-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INSL4 Products

Bioinformatics Tool for INSL4 Recombinant Protein (H00003641-P01)

Discover related pathways, diseases and genes to INSL4 Recombinant Protein (H00003641-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSL4 Recombinant Protein (H00003641-P01)

Discover more about diseases related to INSL4 Recombinant Protein (H00003641-P01).
 

Pathways for INSL4 Recombinant Protein (H00003641-P01)

View related products by pathway.

PTMs for INSL4 Recombinant Protein (H00003641-P01)

Learn more about PTMs related to INSL4 Recombinant Protein (H00003641-P01).
 

Research Areas for INSL4 Recombinant Protein (H00003641-P01)

Find related products by research area.

Blogs on INSL4

There are no specific blogs for INSL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human INSL4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INSL4