Novus Biologicals products are now on bio-techne.com

Recombinant Human PAFAH1B2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PAFAH1B2 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 229 of Human PAFAH1B2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
PAFAH1B2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
50.93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PAFAH1B2 GST (N-Term) Protein

  • EC 3.1.1.47
  • intracellular platelet-activating factor acetylhydrolase alpha 2 subunit
  • PAF acetylhydrolase 30 kDa subunit
  • PAF-AH 30 kDa subunit
  • PAFAH subunit beta
  • PAF-AH subunit beta
  • PAF-AH1b alpha 2 subunit
  • PAFAHB
  • platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)
  • platelet-activating factor acetylhydrolase IB subunit beta
  • platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa)

Background

PAFAH1B2( AAH19301, 1 a.a. - 230 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DPLG70
Species: Hu
Applications: ELISA
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46314
Species: Hu, Mu, Rt
Applications: IHC, WB
AF3820
Species: Mu
Applications: IHC, WB
AF2258
Species: Mu
Applications: IHC, WB
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP2-38661
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-30971
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
G-125-C
Species: Hu
Applications:
NBP2-01086
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-84416
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37573
Species: Hu, Pm, Mu, Pm, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
NB100-2216
Species: Ch, Hu, Mu
Applications: ICC/IF, PAGE, WB

Publications for PAFAH1B2 Recombinant Protein (H00005049-P01) (0)

There are no publications for PAFAH1B2 Recombinant Protein (H00005049-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAFAH1B2 Recombinant Protein (H00005049-P01) (0)

There are no reviews for PAFAH1B2 Recombinant Protein (H00005049-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAFAH1B2 Recombinant Protein (H00005049-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAFAH1B2 Products

Research Areas for PAFAH1B2 Recombinant Protein (H00005049-P01)

Find related products by research area.

Blogs on PAFAH1B2

There are no specific blogs for PAFAH1B2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PAFAH1B2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAFAH1B2