PACSIN3 Antibody [Biotin] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 175-424 of human PACSIN3 (NP_057307.2).
Sequence: KADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEEDLRWWRSTHGPGMAMNWPQFEEWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQDEEWSDEESPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVECVGA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PACSIN3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PACSIN3 Antibody [Biotin]
Background
PACSIN3 (protein kinase C and casein kinase substrate in neurons protein 3) is a member of the PACSIN family, a group of adaptor protein that regulate vesicle trafficking via cytoskeletal alterations. PACSIN3 is primarily expressed in skeletal muscle and heart and has been shown to be specifically involved in the trafficking of GLUT 1 in adipocytes. PACSIN3 is also known as SH3 domain-containing 6511, syndapin III, and SDPIII.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Xp
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Publications for PACSIN3 Antibody (NBP3-38573B) (0)
There are no publications for PACSIN3 Antibody (NBP3-38573B).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PACSIN3 Antibody (NBP3-38573B) (0)
There are no reviews for PACSIN3 Antibody (NBP3-38573B).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PACSIN3 Antibody (NBP3-38573B) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PACSIN3 Products
Research Areas for PACSIN3 Antibody (NBP3-38573B)
Find related products by research area.
|
Blogs on PACSIN3