PABPN1 Antibody (7V4X8)

Images

 
Western Blot: PABPN1 Antibody (7V4X8) [NBP3-15539] - Western blot analysis of extracts of various cell lines, using PABPN1 Rabbit mAb (NBP3-15539) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) ...read more
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [NBP3-15539] - Immunofluorescence analysis of U-2 OS cells using PABPN1 Rabbit mAb (NBP3-15539) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Immunohistochemistry-Paraffin: PABPN1 Antibody (7V4X8) [NBP3-15539] - Immunohistochemistry of paraffin-embedded mouse testis using PABPN1 Rabbit mAb (NBP3-15539) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [NBP3-15539] - Immunofluorescence analysis of C6 cells using PABPN1 Rabbit mAb (NBP3-15539) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [NBP3-15539] - Immunofluorescence analysis of NIH-3T3 cells using PABPN1 Rabbit mAb (NBP3-15539) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Immunohistochemistry-Paraffin: PABPN1 Antibody (7V4X8) [NBP3-15539] - Immunohistochemistry of paraffin-embedded rat brain using PABPN1 Rabbit mAb (NBP3-15539) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry-Paraffin: PABPN1 Antibody (7V4X8) [NBP3-15539] - Immunohistochemistry of paraffin-embedded human esophageal using PABPN1 Rabbit mAb (NBP3-15539) at dilution of 1:100 (40x lens).Perform microwave ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
7V4X8
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PABPN1 Antibody (7V4X8) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (Q86U42). MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
PABPN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PABPN1 Antibody (7V4X8)

  • Nuclear poly(A)-binding protein 1
  • OPMD
  • PAB2poly(A) binding protein II
  • PABII
  • PABP-2
  • PABP2polyadenylate-binding protein 2
  • poly(A) binding protein 2
  • poly(A) binding protein, nuclear 1
  • Poly(A)-binding protein 2
  • Poly(A)-binding protein II
  • poly(A)-binding protein, nuclear 1
  • Polyadenylate-binding nuclear protein 1

Background

The PABPN1 gene encodes an abundant nuclear protein that binds with high affinity to nascent poly(A) tails. The protein is required for progressive and efficient polymerization of poly(A) tails on the 3' ends of eukaryotic genes and controls the size of the pol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PABPN1 Antibody (NBP3-15539) (0)

There are no publications for PABPN1 Antibody (NBP3-15539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PABPN1 Antibody (NBP3-15539) (0)

There are no reviews for PABPN1 Antibody (NBP3-15539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PABPN1 Antibody (NBP3-15539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PABPN1 Products

Research Areas for PABPN1 Antibody (NBP3-15539)

Find related products by research area.

Blogs on PABPN1

There are no specific blogs for PABPN1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PABPN1 Antibody (7V4X8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PABPN1