PAAF1 Antibody - BSA Free

Western Blot: PAAF1 Antibody [NBP2-88002] - WB Suggested Anti-PAAF1 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PAAF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PAAF1 Antibody - BSA Free (NBP2-88002) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAAF1. Peptide sequence: FTVNEINKKSIHISCPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAAF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PAAF1 Antibody - BSA Free

• FLJ11848
• PAAF
• proteasomal ATPase-associated factor 1
• Protein G-16
• Rpn14
• WD repeat domain 71
• WD repeat-containing protein 71
• WDR71

Background

PAAF1 inhibits proteasome 26S assembly and proteolytic activity by impairing the association of the 19S regulatorycomplex with the 20S core. In case of HIV-1 infection, recruited by viral Tat to the HIV-1 promoter, where it promotesthe recruitment of 19S regula

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAAF1