p67phox/NOXA2 Antibody

Images

 
Western Blot: NOXA2 Antibody [NBP1-82543] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Immunohistochemistry-Paraffin: NOXA2 Antibody [NBP1-82543] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p67phox/NOXA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
p67phox/NOXA2 Protein (NBP1-82543PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p67phox/NOXA2 Antibody

  • autosomal 2
  • NADPH oxidase activator 2
  • NCF2
  • NCF-2
  • neutrophil cytosol factor 2
  • neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal2)
  • neutrophil cytosolic factor 2
  • NOXA2
  • NOXA2FLJ93058
  • p67phox
  • p67-phox

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NB100-61666
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33449
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for p67phox/NOXA2 Antibody (NBP1-82543) (0)

There are no publications for p67phox/NOXA2 Antibody (NBP1-82543).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p67phox/NOXA2 Antibody (NBP1-82543) (0)

There are no reviews for p67phox/NOXA2 Antibody (NBP1-82543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p67phox/NOXA2 Antibody (NBP1-82543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p67phox/NOXA2 Products

Bioinformatics Tool for p67phox/NOXA2 Antibody (NBP1-82543)

Discover related pathways, diseases and genes to p67phox/NOXA2 Antibody (NBP1-82543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p67phox/NOXA2 Antibody (NBP1-82543)

Discover more about diseases related to p67phox/NOXA2 Antibody (NBP1-82543).
 

Pathways for p67phox/NOXA2 Antibody (NBP1-82543)

View related products by pathway.

PTMs for p67phox/NOXA2 Antibody (NBP1-82543)

Learn more about PTMs related to p67phox/NOXA2 Antibody (NBP1-82543).

Blogs on p67phox/NOXA2

There are no specific blogs for p67phox/NOXA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p67phox/NOXA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCF2
Entrez