p400 Antibody - BSA Free

Western Blot: p400 Antibody [NBP3-35225] - Western blot analysis of various lysates using p400 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p400 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit p400 Antibody - BSA Free (NBP3-35225) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-330 of human p400 (NP_056224.3).
  
  Sequence:
  TLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGVLLPGAGGAAGFGMTSPPPPTSPSRTAVPPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EP400
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 343 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for p400 Antibody - BSA Free

• CAG repeat protein 32
• CAGH32hDomino
• DKFZP434I225
• Domino homolog
• E1A binding protein p400
• E1A-binding protein p400
• EC 3.6.1
• EC 3.6.4.-
• FLJ45115
• KIAA1498p400 kDa SWI2/SNF2-related protein
• KIAA1818
• p400 SWI2/SNF2-related protein
• P400
• TNRC12FLJ42018
• trinucleotide repeat containing 12
• Trinucleotide repeat-containing gene 12 protein

Background

P400 protein is a 250 kd glycoprotein, characteristic of the cerebellum, which is accumulated at the endoplasmic reticulum, at the plasma membrane and at the post-synaptic density of Purkinje cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EP400