p400 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: p400 Antibody [NBP1-88230] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human gall bladder shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p400 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAELPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEEDADDCPGDRESRKDLVLIDSLFIMDQFKAAERMNIGKPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EP400
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
p400 Protein (NBP1-88230PEP)
Publications
Read Publication using NBP1-88230.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%). Reactivity reported in scientific literature (PMID: 24463511)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p400 Antibody

  • CAG repeat protein 32
  • CAGH32hDomino
  • DKFZP434I225
  • Domino homolog
  • E1A binding protein p400
  • E1A-binding protein p400
  • EC 3.6.1
  • EC 3.6.4.-
  • FLJ45115
  • KIAA1498p400 kDa SWI2/SNF2-related protein
  • KIAA1818
  • p400 SWI2/SNF2-related protein
  • P400
  • TNRC12FLJ42018
  • trinucleotide repeat containing 12
  • Trinucleotide repeat-containing gene 12 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, IF
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for p400 Antibody (NBP1-88230)(1)


Reviews for p400 Antibody (NBP1-88230) (0)

There are no reviews for p400 Antibody (NBP1-88230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for p400 Antibody (NBP1-88230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p400 Products

Bioinformatics Tool for p400 Antibody (NBP1-88230)

Discover related pathways, diseases and genes to p400 Antibody (NBP1-88230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p400 Antibody (NBP1-88230)

Discover more about diseases related to p400 Antibody (NBP1-88230).
 

Pathways for p400 Antibody (NBP1-88230)

View related products by pathway.

PTMs for p400 Antibody (NBP1-88230)

Learn more about PTMs related to p400 Antibody (NBP1-88230).
 

Research Areas for p400 Antibody (NBP1-88230)

Find related products by research area.

Blogs on p400

There are no specific blogs for p400, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p400 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EP400