p400 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: p400 Antibody [NBP1-88230] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human cerebral cortex shows moderate nuclear/nucleoli positivity in neurons.

Staining of human rectum shows moderate nuclear/nucleoli positivity in glandular cells.

Staining of human skin shows moderate nuclear/nucleoli positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p400 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit p400 Antibody - BSA Free (NBP1-88230) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-p400 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAELPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEEDADDCPGDRESRKDLVLIDSLFIMDQFKAAERMNIGKPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EP400
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  p400 Protein (NBP1-88230PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for p400 Antibody - BSA Free

• CAG repeat protein 32
• CAGH32hDomino
• DKFZP434I225
• Domino homolog
• E1A binding protein p400
• E1A-binding protein p400
• EC 3.6.1
• EC 3.6.4.-
• FLJ45115
• KIAA1498p400 kDa SWI2/SNF2-related protein
• KIAA1818
• p400 SWI2/SNF2-related protein
• P400
• TNRC12FLJ42018
• trinucleotide repeat containing 12
• Trinucleotide repeat-containing gene 12 protein

Background

P400 protein is a 250 kd glycoprotein, characteristic of the cerebellum, which is accumulated at the endoplasmic reticulum, at the plasma membrane and at the post-synaptic density of Purkinje cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p400 Antibody (NBP1-88230)(1)

Publication using NBP1-88230

• Obri A, Ouararhni K, Papin C et al. ANP32E is a histone chaperone that removes H2A.Z from chromatin. Nature 2014-01-30 [PMID: 24463511]

Bioinformatics

• Gene Symbol: EP400