P2Y11/P2RY11 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit P2Y11/P2RY11 Antibody - Azide and BSA Free (NBP3-15501) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 300-379 of human P2Y11/P2RY11 (NP_002557.2). YVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
P2RY11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for P2Y11/P2RY11 Antibody - Azide and BSA Free
Background
P2Y11, the only Purinergic Receptor that acts via cAMP, may be involved in the differentiation of immunocytes. Immature and mature dendritic cells express P2Y and P2X subtypes, including P2Y11, which are coupled to increases in intracellular Ca2+, membrane depolarization, and secretion of inflammatory cytokines. It has been suggested that ATP/P2Y11 contributes to sympathetic stimulation of renin, as well as to renin responses after tissue damage, such as that which occurs with kidney disease and myocardial infarct. Intergenic splicing between the P2Y11 and SSF1 genes changes gene expression, the first case involving a GPCR Communi et al., 2001. Prototypes for this cluster have been chosen to be uniquely P2Y11. P2Y11 has been reported in monocyte-derived dendritic cells, lymphocytes from patients with chronic lymphocytic leukemia, brain, heart, kidney, liver, skeletal muscle, spleen, and testis. ESTs have been isolated from normal human prostate, pancreas, and pooled brain, lung, and testis libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for P2Y11/P2RY11 Antibody (NBP3-15501) (0)
There are no publications for P2Y11/P2RY11 Antibody (NBP3-15501).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for P2Y11/P2RY11 Antibody (NBP3-15501) (0)
There are no reviews for P2Y11/P2RY11 Antibody (NBP3-15501).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for P2Y11/P2RY11 Antibody (NBP3-15501) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional P2Y11/P2RY11 Products
Research Areas for P2Y11/P2RY11 Antibody (NBP3-15501)
Find related products by research area.
|
Blogs on P2Y11/P2RY11