P2Y11/P2RY11 Antibody - Azide and BSA Free

Western Blot: P2Y11/P2RY11 Antibody [NBP3-15501] - Western blot analysis of extracts of various cell lines, using P2Y11/P2RY11 Rabbit pAb (NBP3-15501) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

P2Y11/P2RY11 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-379 of human P2Y11/P2RY11 (NP_002557.2). YVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for P2Y11/P2RY11 Antibody - Azide and BSA Free

• P2RY11
• P2Y11
• P2Y11P2Y purinoceptor 11
• purinergic receptor P2Y, G-protein coupled, 11
• purinergic receptor P2Y11

Background

P2Y11, the only Purinergic Receptor that acts via cAMP, may be involved in the differentiation of immunocytes. Immature and mature dendritic cells express P2Y and P2X subtypes, including P2Y11, which are coupled to increases in intracellular Ca2+, membrane depolarization, and secretion of inflammatory cytokines. It has been suggested that ATP/P2Y11 contributes to sympathetic stimulation of renin, as well as to renin responses after tissue damage, such as that which occurs with kidney disease and myocardial infarct. Intergenic splicing between the P2Y11 and SSF1 genes changes gene expression, the first case involving a GPCR Communi et al., 2001. Prototypes for this cluster have been chosen to be uniquely P2Y11. P2Y11 has been reported in monocyte-derived dendritic cells, lymphocytes from patients with chronic lymphocytic leukemia, brain, heart, kidney, liver, skeletal muscle, spleen, and testis. ESTs have been isolated from normal human prostate, pancreas, and pooled brain, lung, and testis libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: P2RY11