p15INK4b/CDKN2B Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CDKN2B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for p15INK4b/CDKN2B Antibody - BSA Free
Background
The normal progression of cells through the cell cycle is under the control of the cyclin dependent protein kinases Cdk4 and Cdk6 which are subject to inhibition by the mitotic inhibitory protein, p16. An isolated member of the p16 family has been designated p15. p15 expression is upregulated approximately 30-fold in TGFbeta-treated human keratinocytes, suggesting that p15 may act as an effector of TGFbeta-mediated cell cycle arrest. The gene encoding p15 has been mapped to chromosome 9p21 at a position adjacent to the p16 gene at a site of frequent chromosomal abnormality in human tumors. It has been suggested that p15 may function as an effector of TGFbeta-mediated cell cycle arrest through inhibition of Cdk4 and Cdk6 kinases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for p15INK4b/CDKN2B Antibody (NBP2-38023) (0)
There are no publications for p15INK4b/CDKN2B Antibody (NBP2-38023).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for p15INK4b/CDKN2B Antibody (NBP2-38023) (0)
There are no reviews for p15INK4b/CDKN2B Antibody (NBP2-38023).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for p15INK4b/CDKN2B Antibody (NBP2-38023) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional p15INK4b/CDKN2B Products
Research Areas for p15INK4b/CDKN2B Antibody (NBP2-38023)
Find related products by research area.
|
Blogs on p15INK4b/CDKN2B