p114RhoGEF Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: p114RhoGEF Antibody [NBP1-92238] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: p114RhoGEF Antibody [NBP1-92238] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: p114RhoGEF Antibody [NBP1-92238] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.

Immunohistochemistry-Paraffin: p114RhoGEF Antibody [NBP1-92238] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: p114RhoGEF Antibody [NBP1-92238] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p114RhoGEF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit p114RhoGEF Antibody - BSA Free (NBP1-92238) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-p114RhoGEF Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGEF18
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  p114RhoGEF Protein (NBP1-92238PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25646088)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for p114RhoGEF Antibody - BSA Free

• 114 kDa Rho-specific guanine nucleotide exchange factor
• EC 3.4.24
• EC 3.6.1
• KIAA0521rho guanine nucleotide exchange factor 18
• MGC15913
• p114RhoGEF
• P114-RhoGEF
• P114-RHO-GEF
• Rho/Rac guanine nucleotide exchange factor (GEF) 18
• Rho/Rac guanine nucleotide exchange factor 18
• Rho-specific guanine nucleotide exchange factor p114
• SA-RhoGEF
• Septin-associated RhoGEF

Background

Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p114RhoGEF Antibody (NBP1-92238)(1)

Publication using NBP1-92238

• Artym VV, Swatkoski S, Matsumoto K et al. Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network. J Cell Biol 2015-02-02 [PMID: 25646088]

Bioinformatics

• Gene Symbol: ARHGEF18