OXPAT Recombinant Protein Antigen

Images

 
There are currently no images for OXPAT Recombinant Protein Antigen (NBP3-17192PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OXPAT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OXPAT

Source: E. coli

Amino Acid Sequence: GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLIN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17192.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OXPAT Recombinant Protein Antigen

  • lipid storage droplet protein 5
  • LSDA5
  • LSDP5
  • MLDP
  • OXPAT
  • perilipin 5
  • perilipin-5

Background

OXPAT is a novel PAT-1 protein that is expressed in highly oxidative tissues. Lipid droplet proteins of the PAT family regulate cellular neutral lipid stores. OXPAT is induced by physiological (fasting), pathophysiological (insulin deficiency), pharmacological (peroxisome proliferator-activated receptor [PPAR] agonists), and genetic (muscle-specific PPAR alpha overexpression) disturbances that increase fatty acid utilization. It is suggested that OXPAT is a marker for PPAR activation and fatty acid oxidation. OXPAT may also contribute to adaptive responses to the fatty acid responsibility that accompanies fasting, insulin deficiency, and overnutrition responses that are defective in obesity and type 2 diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB110-40760
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: ICC/IF, WB
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-13776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
AF6989
Species: Mu
Applications: IHC
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00051099-M01
Species: Bv, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DLP00
Species: Hu
Applications: ELISA
NBP3-17192PEP
Species: Hu
Applications: AC

Publications for OXPAT Recombinant Protein Antigen (NBP3-17192PEP) (0)

There are no publications for OXPAT Recombinant Protein Antigen (NBP3-17192PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OXPAT Recombinant Protein Antigen (NBP3-17192PEP) (0)

There are no reviews for OXPAT Recombinant Protein Antigen (NBP3-17192PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OXPAT Recombinant Protein Antigen (NBP3-17192PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OXPAT Products

Research Areas for OXPAT Recombinant Protein Antigen (NBP3-17192PEP)

Find related products by research area.

Blogs on OXPAT.

OXPAT: Regulating Lipid Metabolism during Dietary Fluctuations
OXPAT is the mammalian form of the PAT (perilipin, adipophilin, and TIP47) gene family that consists of proteins associated with lipid droplets (LDs) in fat-storing adipocyte cells. They serve to protect LDs from natural lipases responsible for breaki...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OXPAT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLIN5