OX40 Ligand/TNFSF4 Antibody Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
TNFSF4 (NP_003317.1, 1 a.a. - 183 a.a.) full-length human protein. MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
TNFSF4 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for OX40 Ligand/TNFSF4 Antibody
Background
CD252 is a 35 kD member of the TNF superfamily also known as OX40L and CD134L. The OX40 ligand is expressed on activated B cells and antigen presenting cells. OX40 ligand interacts with OX40 antigen (CD134) expressed predominantly on activated T cells to increase proliferation and IL-2 production, and to enhance proliferation and immunoglobulin secretion in activated B cells. The RM134L antibody can inhibit OX40/OX40 ligand interactions and block the costimulatory activity of OX40L.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for OX40 Ligand/TNFSF4 Antibody (H00007292-B01P) (0)
There are no publications for OX40 Ligand/TNFSF4 Antibody (H00007292-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for OX40 Ligand/TNFSF4 Antibody (H00007292-B01P) (0)
There are no reviews for OX40 Ligand/TNFSF4 Antibody (H00007292-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for OX40 Ligand/TNFSF4 Antibody (H00007292-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional OX40 Ligand/TNFSF4 Products
Research Areas for OX40 Ligand/TNFSF4 Antibody (H00007292-B01P)
Find related products by research area.
|
Blogs on OX40 Ligand/TNFSF4