OTUD7B/Cezanne/ZA20D1 Recombinant Protein Antigen

Images

 
There are currently no images for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OTUD7B/Cezanne/ZA20D1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OTUD7B.

Source: E.coli

Amino Acid Sequence: PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG

Protein/Peptide Type
Recombinant Protein Antigen
Gene
OTUD7B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88095.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OTUD7B/Cezanne/ZA20D1 Recombinant Protein Antigen

  • cellular zinc finger NF-kappaB Cezanne
  • Cellular zinc finger NF-kappa-B protein
  • Cezanne
  • CEZANNEA20 domain containing 1
  • EC 3.4.19.12
  • OTU domain containing 7B
  • OTU domain-containing protein 7B
  • OTUD7B
  • ZA20D1
  • Zinc finger A20 domain-containing protein 1
  • Zinc finger protein Cezanne

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
NLS272
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC-P
NBP1-01469
Species: Hu
Applications: WB, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88095PEP
Species: Hu
Applications: AC

Publications for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP) (0)

There are no publications for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP) (0)

There are no reviews for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OTUD7B/Cezanne/ZA20D1 Products

Bioinformatics Tool for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP)

Discover related pathways, diseases and genes to OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP)

Discover more about diseases related to OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP).
 

Pathways for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP)

View related products by pathway.

PTMs for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP)

Learn more about PTMs related to OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP).
 

Research Areas for OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP)

Find related products by research area.

Blogs on OTUD7B/Cezanne/ZA20D1

There are no specific blogs for OTUD7B/Cezanne/ZA20D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OTUD7B/Cezanne/ZA20D1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OTUD7B
Entrez