OTOP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: OTOP1 Antibody [NBP1-86306] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: OTOP1 Antibody [NBP1-86306] - Staining of human duodenum shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: OTOP1 Antibody [NBP1-86306] - Staining of human endometrium shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: OTOP1 Antibody [NBP1-86306] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OTOP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGVLNESKHQLNEHKEWLITLGFGNITTVLDDHTPQCNCTPPTLCTAISHGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OTOP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  OTOP1 Protein (NBP1-86306PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OTOP1 Antibody - BSA Free

• MGC163302
• MGC163304
• otopetrin 1
• otopetrin-1

Background

OTOP1 is required for normal formation of otoconia in the inner ear. Inhibits P2Y purinoceptors. Modulates calciumhomeostasis and influx of calcium in response to extracellular ATP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OTOP1 Antibody (NBP1-86306)(2)

Publications using NBP1-86306

• Tu YH, Liu N, Xiao C et al. Loss of Otopetrin 1 affects thermoregulation during fasting in mice PloS one 2023-10-09 [PMID: 37812612] (WB, Mouse)
  
  Details:
  1:500 WB dilution
• Zhang J, Jin H, Zhang W et al. Sour Sensing from the Tongue to the Brain Cell [PMID: 31543264]

Bioinformatics

• Gene Symbol: OTOP1