USH1G Antibody

Images

 
Immunohistochemistry-Paraffin: USH1G Antibody [NBP1-89076] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USH1G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USH1G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
USH1G Protein (NBP1-89076PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USH1G Antibody

  • ANKS4A
  • FLJ33924
  • SANSSans
  • Scaffold protein containing ankyrin repeats and SAM domain
  • Usher syndrome 1G (autosomal recessive)
  • Usher syndrome type-1G protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89189
Species: Hu
Applications: IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6729
Species: Hu
Applications: WB, IHC, ICC
42720002
Species: Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for USH1G Antibody (NBP1-89076) (0)

There are no publications for USH1G Antibody (NBP1-89076).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USH1G Antibody (NBP1-89076) (0)

There are no reviews for USH1G Antibody (NBP1-89076). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for USH1G Antibody (NBP1-89076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USH1G Products

Bioinformatics Tool for USH1G Antibody (NBP1-89076)

Discover related pathways, diseases and genes to USH1G Antibody (NBP1-89076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USH1G Antibody (NBP1-89076)

Discover more about diseases related to USH1G Antibody (NBP1-89076).
 

Pathways for USH1G Antibody (NBP1-89076)

View related products by pathway.

Blogs on USH1G

There are no specific blogs for USH1G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USH1G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USH1G
Entrez
Uniprot