Osterix/Sp7 Antibody (2G6) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: Osterix/Sp7 Antibody (2G6) [H00121340-M01] - Analysis of monoclonal antibody to SP7 on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: Osterix/Sp7 Antibody (2G6) [H00121340-M01] - Detection limit for recombinant GST tagged SP7 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Osterix/Sp7 Antibody (2G6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Osterix/Sp7 Antibody (2G6) - Azide and BSA Free (H00121340-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH
• Specificity: SP7 (2G6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SP7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osterix/Sp7 Antibody (2G6) - Azide and BSA Free

• MGC126598
• Osterix
• OSX
• OSXosterix
• Sp7 transcription factor
• Sp7
• transcription factor Sp7
• Zinc finger protein osterix

Background

SP7 is a C2H2-type zinc finger transcription factor of the SP gene family and a putative master regulator of bone cell differentiation (Gao et al., 2004 [PubMed 15474293]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SP7
• Entrez:
  • 121340(Human)
• OMIM:
  • 606633(Human)
• Uniprot:
  • NP_690599(Human)