Recombinant Human Osteocalcin Protein

Images

 
SDS-Page: Recombinant Human Osteocalcin Protein [H00000632-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Osteocalcin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-49 of Human BGLAP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BGLAP
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Osteocalcin Protein

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Background

BGLAP - bone gamma-carboxyglutamate (gla) protein (osteocalcin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF6146
Species: Hu
Applications: ICC
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000632-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Osteocalcin Partial Recombinant Protein (H00000632-Q01) (0)

There are no publications for Osteocalcin Partial Recombinant Protein (H00000632-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteocalcin Partial Recombinant Protein (H00000632-Q01) (0)

There are no reviews for Osteocalcin Partial Recombinant Protein (H00000632-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteocalcin Partial Recombinant Protein (H00000632-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Osteocalcin Products

Bioinformatics Tool for Osteocalcin Partial Recombinant Protein (H00000632-Q01)

Discover related pathways, diseases and genes to Osteocalcin Partial Recombinant Protein (H00000632-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteocalcin Partial Recombinant Protein (H00000632-Q01)

Discover more about diseases related to Osteocalcin Partial Recombinant Protein (H00000632-Q01).
 

Pathways for Osteocalcin Partial Recombinant Protein (H00000632-Q01)

View related products by pathway.

PTMs for Osteocalcin Partial Recombinant Protein (H00000632-Q01)

Learn more about PTMs related to Osteocalcin Partial Recombinant Protein (H00000632-Q01).
 

Research Areas for Osteocalcin Partial Recombinant Protein (H00000632-Q01)

Find related products by research area.

Blogs on Osteocalcin

There are no specific blogs for Osteocalcin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Osteocalcin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BGLAP
Entrez