Osteocalcin Antibody

Images

 
Western Blot: Osteocalcin Antibody [H00000632-B01P] - Analysis of BGLAP expression in transfected 293T cell line by BGLAP polyclonal antibody. Lane 1: BGLAP transfected lysate(11 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Osteocalcin Antibody Summary

Immunogen
BGLAP (NP_954642.1, 1 a.a. - 100 a.a.) full-length human protein. MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
BGLAP
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osteocalcin Antibody

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF6146
Species: Hu
Applications: ICC
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000632-B01P
Species: Hu
Applications: WB

Publications for Osteocalcin Antibody (H00000632-B01P) (0)

There are no publications for Osteocalcin Antibody (H00000632-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteocalcin Antibody (H00000632-B01P) (0)

There are no reviews for Osteocalcin Antibody (H00000632-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteocalcin Antibody (H00000632-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteocalcin Products

Bioinformatics Tool for Osteocalcin Antibody (H00000632-B01P)

Discover related pathways, diseases and genes to Osteocalcin Antibody (H00000632-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteocalcin Antibody (H00000632-B01P)

Discover more about diseases related to Osteocalcin Antibody (H00000632-B01P).
 

Pathways for Osteocalcin Antibody (H00000632-B01P)

View related products by pathway.

PTMs for Osteocalcin Antibody (H00000632-B01P)

Learn more about PTMs related to Osteocalcin Antibody (H00000632-B01P).
 

Research Areas for Osteocalcin Antibody (H00000632-B01P)

Find related products by research area.

Blogs on Osteocalcin

There are no specific blogs for Osteocalcin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteocalcin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BGLAP
Entrez
Uniprot