OSTalpha Antibody

Immunohistochemistry-Paraffin: OSTalpha Antibody [NBP1-87507] - Staining of human small intestine shows high expression.

Immunohistochemistry-Paraffin: OSTalpha Antibody [NBP1-87507] - Staining in human small intestine and pancreas tissues using anti-SLC51A antibody. Corresponding SLC51A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OSTalpha Antibody [NBP1-87507] - Staining of human pancreas shows low expression as expected.

Product Discontinued

OSTalpha Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQL
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC51A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OSTalpha Antibody

• MGC39807
• organic solute transporter alpha
• organic solute transporter subunit alpha
• OSTA
• OST-alpha

Background

Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateraltransporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the majorspecies of bile acids

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC51A