OSR1 Antibody (1G9)

Images

 
Sandwich ELISA: OSR1 Antibody (1G9) [H00130497-M10] - Detection limit for recombinant GST tagged OSR1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OSR1 Antibody (1G9) Summary

Immunogen
OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
Specificity
OSR1 - odd-skipped related 1 (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OSR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.
Publications
Read Publications using H00130497-M10.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OSR1 Antibody (1G9)

  • ODDodd-skipped (Drosophila) homolog
  • odd-skipped homolog
  • odd-skipped related 1 (Drosophila)
  • protein odd-skipped-related 1

Background

ORS1 is a transcription factor that plays a role in the regulation of embryonic heart and urogenital development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P, IP
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
NB100-75623
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56333
Species: Hu
Applications: WB, ICC/IF
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, KO
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-41384
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-94269
Species: Hu, Mu, Rt
Applications: WB, IHC
H00005076-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00130497-M10
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSR1 Antibody (H00130497-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OSR1 Products

Bioinformatics Tool for OSR1 Antibody (H00130497-M10)

Discover related pathways, diseases and genes to OSR1 Antibody (H00130497-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSR1 Antibody (H00130497-M10)

Discover more about diseases related to OSR1 Antibody (H00130497-M10).
 

Pathways for OSR1 Antibody (H00130497-M10)

View related products by pathway.

PTMs for OSR1 Antibody (H00130497-M10)

Learn more about PTMs related to OSR1 Antibody (H00130497-M10).

Blogs on OSR1

There are no specific blogs for OSR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSR1 Antibody (1G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol OSR1
Entrez
OMIM
Uniprot