Home » OSR1 » OSR1 Antibodies » OSR1 Antibody (1G9)

OSR1 Antibody (1G9)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: OSR1 Antibody (1G9) [H00130497-M10] - Detection limit for recombinant GST tagged OSR1 is approximately 1ng/ml as a capture antibody.
Sandwich ELISA: OSR1 Antibody (1G9) [H00130497-M10] - Detection limit for recombinant GST tagged OSR1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

OSR1 Antibody (1G9) Summary

Immunogen
OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
Specificity
OSR1 - odd-skipped related 1 (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OSR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.
Publications
Read Publications using H00130497-M10.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OSR1 Antibody (1G9)

  • ODDodd-skipped (Drosophila) homolog
  • odd-skipped homolog
  • odd-skipped related 1 (Drosophila)
  • protein odd-skipped-related 1

Background

ORS1 is a transcription factor that plays a role in the regulation of embryonic heart and urogenital development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

STK39 Antibody
(OTI4E3)
NBP1-48021
Flow Cytometry: STK39 Antibody (4E3) [NBP1-48021] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-STK39 antibody, and then analyzed by flow cytometry.
Western Blot: STK39 Antibody (4E3) [NBP1-48021] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY STK39 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-STK39.
Immunocytochemistry/Immunofluorescence: STK39 Antibody (4E3) [NBP1-48021] - Immunofluorescent staining of COS7 cells using anti-STK39 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SLC12A3 Antibody
NBP1-44270
Immunocytochemistry/Immunofluorescence: SLC12A3 Antibody [NBP1-44270] - Tissue: kidney tissue. Species: Rat. Primary Antibody: Rabbit Anti-NCC Polyclonal Antibody at 1:200. Secondary Antibody: FITC Goat Anti-Rabbit (green).
Western Blot: SLC12A3 Antibody [NBP1-44270] - analysis of Rat tissue lysates showing detection of NCC protein using Rabbit Anti-NCC Polyclonal Antibody . Primary Antibody: Rabbit Anti-NCC Polyclonal Antibody at 1:1000.
(1 Publication)
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
WNK4 Antibody
NB600-284
Western Blot: WNK4 Antibody [NB600-284] - Western Blot Image of anti-WNK4. Whole cell protein from Hek293 was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-WNK4 in 1% milk and detected with an anti-rabbit HRP secondary antibody using chemiluminescence
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt
Applications: EM, ICC/IF (-), IHC, IHC-Fr, IHC-P, IP, WB
WNK1 Antibody
NB600-225
Western Blot: WNK1 Antibody [NB600-225] - Detection of the short form of WNK1 in F-11 cell lysate.
Immunocytochemistry/Immunofluorescence: WNK1 Antibody [NB600-225] - WNK1 antibody was tested in HEK293 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
Flow Cytometry: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Analysis using the Alexa Fluor(R) 488 conjugate of NB100-105. Staining of HIF-1 alpha in H929 cells using HIF-1 alpha antibody. Flow cytometry image submitted by a verified customer review.
Flow Cytometry: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Analysis using the Alexa Fluor (R) 488 conjugate of NB100-105. Staining of HIF-1 alpha in multiple myeloma cells: H929 cells (0.5 x 10^6) were stained with Alexa Fluor 488(R) conjugated HIF-1 alpha antibody (NB100-105AF488). Image courtesy of Dr. Barbara Muz at Washington University in St. Louis School of Medicine.
(45 Reviews)
(918 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, TCS, WB
NKCC1/SLC12A2
Antibody
NB100-75623
Western Blot: NKCC1/SLC12A2 Antibody [NB100-75623] - E. coli-derived fusion protein as test antigen. Affinity-purified IgY dilution 1:2000, Goat anti-IgY-HRP dilution 1:1000. Colorimetric method for signal development (anti-SLC12A2).
Immunohistochemistry: NKCC1/SLC12A2 Antibody [NB100-75623] - Human colon tissue was incubated with anti-NKCC1 antibody at 5 ug/mL (1:200) overnight at 4C and detected with Alexa Fluor 488 Goat anti-Chicken (1:200 Invitrogen, cat# A11039). Nuclei stained with DAPI. Image from verified customer review.
(1 Review)
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, WB
MST3 Antibody
NBP1-87833
Western Blot: MST3 Antibody [NBP1-87833] - Analysis using Anti-STK24 antibody NBP1-87833 (A) shows similar pattern to independent antibody NBP1-87834 (B).
Immunocytochemistry/Immunofluorescence: MST3 Antibody [NBP1-87833] - Staining of human cell line A-431 shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver, skin, small intestine and testis using Anti-STK24 antibody NBP1-87833 (A) shows similar protein distribution across tissues to independent antibody NBP1-87834 (B).
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NKCC2/SLC12A1
Antibody
NBP1-80993
Immunocytochemistry/Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Western Blot: NKCC2/SLC12A1 Antibody [NBP1-80993] - Western blot experiments were performed to determine the protein expression in eight corresponding normal (N) and clear cell renal cell carcinoma (T) tissue. NPTX2 was increased in tumor tissue, whereas FXYD4, KNG1, SLC12A1 and SLC6A3 were decreased in tumors. NDUF4AL2 levels were similar, but the bands were of different size in tumor and normal samples Image collected and cropped by CiteAb from the following publication (http://molecular-cancer.biomedcentral.com/articles/10.1186/s12943-016-0495-5), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
OXSR1 Antibody
(3A8)
H00009943-M16
Immunocytochemistry/Immunofluorescence: OXSR1 Antibody (3A8) [H00009943-M16] - Analysis of monoclonal antibody to OXSR1 on HeLa cell. Antibody concentration 30 ug/ml
Immunohistochemistry-Paraffin: OXSR1 Antibody (3A8) [H00009943-M16] - Analysis of monoclonal antibody to OXSR1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml
Sandwich ELISA: OXSR1 Antibody (3A8) [H00009943-M16] - Detection limit for recombinant GST tagged OXSR1 is approximately 0.03ng/ml as a capture antibody.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
OSR2 Antibody
NBP2-56333
Western Blot: OSR2 Antibody [NBP2-56333] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: OSR2 Antibody [NBP2-56333] - Staining of human cell line HEK 293 shows localization to plasma membrane.
Species: Hu
Applications: ICC/IF, WB
HYPB Antibody
(CL9956)
NBP2-88941
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P
BMAL1 Antibody
NB100-2288
Flow (Intracellular): BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on HeLa cells with NB100-2288AF647(blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunohistochemistry: BMAL1 Antibody [NB100-2288] - Analysis of BMAL1 in mouse cerebral cortex (left: wt, right: Bmal1 KO) using anti-BMAL1 antibody. Image from verified customer review.
Flow Cytometry: BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on Jurkat cells with NB100-2288 and a matched isotype control. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(1 Review)
(34 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Huntingtin
Antibody (JB89-34)
NBP2-75531
Flow Cytometry: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of SH-SY-5Y cells with Huntingtin antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunohistochemistry-Paraffin: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of paraffin-embedded human colon cancer tissue using anti-Huntingtin antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of paraffin-embedded human breast tissue using anti-Huntingtin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
Von Hippel Lindau
Antibody (OTI1E1)
NBP2-45411
Immunohistochemistry: Von Hippel Lindau Antibody (1E1) [NBP2-45411] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Von Hippel Lindau Antibody (1E1) [NBP2-45411] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Von Hippel Lindau Antibody (1E1) [NBP2-45411] - Analysis of Human endometrium tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
VEGF [HRP]
DVE00
(26 Reviews)
(561 Publications)
Species: Hu
Applications: ELISA
WNK3 Antibody
NBP2-94269
Immunohistochemistry-Paraffin: WNK3 Antibody [NBP2-94269] - Paraffin-embedded human appendix using WNK3 .
Immunohistochemistry-Paraffin: WNK3 Antibody [NBP2-94269] - Paraffin-embedded human liver cancer using WNK3 .
Western Blot: WNK3 Antibody [NBP2-94269] - Analysis of extracts of various cell lines, using WNK3 at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Pax2 Antibody (3C7)
H00005076-M01
Western Blot: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.Lane 1: PAX2 transfected lysate(47.41 KDa).Lane 2: Non-transfected lysate.
ELISA: Pax2 Antibody (3C7) [H00005076-M01] - Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 0.5 ug/ml.
(10 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
CHN 1 Antibody
(OTI2G6)
NBP2-46290
Western Blot: CHN 1 Antibody (OTI2G6) [NBP2-46290] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CHN 1.
Immunocytochemistry/Immunofluorescence: CHN 1 Antibody (OTI2G6) [NBP2-46290] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY CHN 1.
Immunohistochemistry-Paraffin: CHN 1 Antibody (OTI2G6) [NBP2-46290] - Analysis of Carcinoma of Human kidney tissue.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
OSR1 Antibody (1G9)
H00130497-M10
OSR1 Antibody (1G9)
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA

Publications for OSR1 Antibody (H00130497-M10)(4)


Reviews for OSR1 Antibody (H00130497-M10) (0)

There are no reviews for OSR1 Antibody (H00130497-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSR1 Antibody (H00130497-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional OSR1 Products

Bioinformatics Tool for OSR1 Antibody (H00130497-M10)

Discover related pathways, diseases and genes to OSR1 Antibody (H00130497-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSR1 Antibody (H00130497-M10)

Discover more about diseases related to OSR1 Antibody (H00130497-M10).
 

Pathways for OSR1 Antibody (H00130497-M10)

View related products by pathway.

PTMs for OSR1 Antibody (H00130497-M10)

Learn more about PTMs related to OSR1 Antibody (H00130497-M10).

Blogs on OSR1

There are no specific blogs for OSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSR1 Antibody (1G9) and receive a gift card or discount.


Bioinformatics

Gene Symbol OSR1
Entrez
OMIM
Uniprot