OSBPL9 Antibody - BSA Free

Western Blot: OSBPL9 Antibody [NBP1-55152] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: OSBPL9 Antibody [NBP1-55152] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OSBPL9 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to OSBPL9(oxysterol binding protein-like 9) The peptide sequence was selected from the N terminal of OSBPL9. Peptide sequence HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSBPL9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OSBPL9 Antibody - BSA Free

• FLJ12492
• FLJ14629
• FLJ14801
• FLJ32055
• FLJ34384
• ORP-9
• ORP9MGC15035
• OSBP4
• OSBP-related protein 9
• oxysterol binding protein-like 9
• oxysterol-binding protein-related protein 9

Background

OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain.This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Multiple transcript variants, most of which encode distinct isoforms, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSBPL9
• Uniprot:
  • Q8TAS8(Human)