![Western Blot: ORC5L Antibody [NBP2-83346] - Host: Rabbit. Target Name: ORC5. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/ORC5L-Antibody-Western-Blot-NBP2-83346-img0001.jpg "Western Blot: ORC5L Antibody [NBP2-83346] - Host: Rabbit. Target Name: ORC5. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml")
| Description | Novus Biologicals Rabbit ORC5L Antibody - BSA Free (NBP2-83346) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ORC5L. Peptide sequence: SQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ORC5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ORC5 |
