OR7D4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit OR7D4 Antibody - BSA Free (NBP2-84204) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7D4. Peptide sequence: GVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGALERLLS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OR7D4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for OR7D4 Antibody - BSA Free
Background
OR7D4 is a gene that codes for a protein that is an odorant receptor and is activated by androstenone and the steroid androstadienone, and is 312 amino acids in length with a weight of approximately 34 kDa. Current research is being done on diseases and disorders linked to this gene including neuronitis. OR7D4 has also been shown to have interactions with OR52E6, OR10AD1, OR10G4, OR10P1, and OR10W1 in pathways such as the GPCR downstream signaling and olfactory signaling pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for OR7D4 Antibody (NBP2-84204) (0)
There are no publications for OR7D4 Antibody (NBP2-84204).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for OR7D4 Antibody (NBP2-84204) (0)
There are no reviews for OR7D4 Antibody (NBP2-84204).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for OR7D4 Antibody (NBP2-84204) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional OR7D4 Products
Blogs on OR7D4