Optimedin Antibody


Western Blot: Optimedin Antibody [NBP1-74249] - Titration: 1.0 ug/ml Positive Control: Mouse Liver.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

Optimedin Antibody Summary

Synthetic peptides corresponding to the C terminal of Olfm3. Immunizing peptide sequence PKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Olfm3 and was validated on Western blot.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Optimedin Antibody

  • noelin 3
  • noelin-3
  • NOELIN3_V1
  • NOELIN3_V2
  • NOELIN3_V3
  • NOELIN3_V4
  • NOELIN3_V5
  • NOELIN3_V6
  • olfactomedin 3
  • olfactomedin related ER localized protein 3
  • olfactomedin-3
  • Optimedin


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB
Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P

Publications for Optimedin Antibody (NBP1-74249) (0)

There are no publications for Optimedin Antibody (NBP1-74249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Optimedin Antibody (NBP1-74249) (0)

There are no reviews for Optimedin Antibody (NBP1-74249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Optimedin Antibody (NBP1-74249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Optimedin Products

Bioinformatics Tool for Optimedin Antibody (NBP1-74249)

Discover related pathways, diseases and genes to Optimedin Antibody (NBP1-74249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Optimedin Antibody (NBP1-74249)

Discover more about diseases related to Optimedin Antibody (NBP1-74249).

Pathways for Optimedin Antibody (NBP1-74249)

View related products by pathway.

Blogs on Optimedin

There are no specific blogs for Optimedin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Optimedin Antibody and receive a gift card or discount.


Gene Symbol OLFM3