OPA3 Antibody [DyLight 680] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 25-179 of human OPA3 (NP_079412.1).
Sequence: NRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OPA3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for OPA3 Antibody [DyLight 680]
Background
The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have beenshown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multipletranscript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC
Species: Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Ch, Hu, Pm, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for OPA3 Antibody (NBP3-38494FR) (0)
There are no publications for OPA3 Antibody (NBP3-38494FR).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for OPA3 Antibody (NBP3-38494FR) (0)
There are no reviews for OPA3 Antibody (NBP3-38494FR).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for OPA3 Antibody (NBP3-38494FR) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional OPA3 Products
Research Areas for OPA3 Antibody (NBP3-38494FR)
Find related products by research area.
|
Blogs on OPA3