Oncostatin M/OSM Antibody

Images

 
Western Blot: Oncostatin M/OSM Antibody [H00005008-D01] - Analysis of OSM expression in transfected 293T cell line by OSM polyclonal antibody.Lane 1: OSM transfected lysate(28.50 KDa).Lane 2: Non-transfected lysate.
Western Blot: Oncostatin M/OSM Antibody [H00005008-D01] - Analysis of OSM expression in transfected 293T cell line (H00005008-T02) by OSM MaxPab polyclonal antibody. Lane 1: OSM transfected lysate(28.50 KDa). Lane 2: ...read more
Immunoprecipitation: Oncostatin M/OSM Antibody [H00005008-D01] - OSM transfected lysate using anti-OSM MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with OSM purified MaxPab ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Oncostatin M/OSM Antibody Summary

Immunogen
OSM (NP_065391.1, 1 a.a. - 252 a.a.) full-length human protein. MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Specificity
OSM - oncostatin M,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSM
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunoprecipitation
Application Notes
Experiments in IP: Recommended starting volume is 30-40ul antibody and 10ul protein A magnetic beads (50ug/ul). For over expression lysate with total protein concentration of 1ug/ul, the recommended starting value for loading sample is 200 ul. For other sample types, the amount of lysate will need to be optimised by each end-user

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Serum; Concentration has not been determined (total IgG concentration expected in normal serum is approximately 1-10mg/ml)
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Oncostatin M/OSM Antibody

  • MGC20461
  • oncostatin M
  • oncostatin-M
  • OSM

Background

Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
557-NT/CF
Species: Rt
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-249-NA
Species: Hu
Applications: WB, Neut
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF662
Species: Mu
Applications: WB, IHC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
H00005008-D01
Species: Hu
Applications: WB, IP

Publications for Oncostatin M/OSM Antibody (H00005008-D01) (0)

There are no publications for Oncostatin M/OSM Antibody (H00005008-D01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Oncostatin M/OSM Antibody (H00005008-D01) (0)

There are no reviews for Oncostatin M/OSM Antibody (H00005008-D01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Oncostatin M/OSM Antibody (H00005008-D01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Oncostatin M/OSM Products

Bioinformatics Tool for Oncostatin M/OSM Antibody (H00005008-D01)

Discover related pathways, diseases and genes to Oncostatin M/OSM Antibody (H00005008-D01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Oncostatin M/OSM Antibody (H00005008-D01)

Discover more about diseases related to Oncostatin M/OSM Antibody (H00005008-D01).
 

Pathways for Oncostatin M/OSM Antibody (H00005008-D01)

View related products by pathway.

PTMs for Oncostatin M/OSM Antibody (H00005008-D01)

Learn more about PTMs related to Oncostatin M/OSM Antibody (H00005008-D01).
 

Research Areas for Oncostatin M/OSM Antibody (H00005008-D01)

Find related products by research area.

Blogs on Oncostatin M/OSM

There are no specific blogs for Oncostatin M/OSM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Oncostatin M/OSM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OSM
Entrez