Oncomodulin Antibody

Images

 
Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568] - Staining of human pancreas shows moderate nuclear positivity in a fraction of cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Oncomodulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Oncomodulin Protein (NBP2-14568PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Oncomodulin Antibody

  • OCM
  • OCM1
  • OCMN
  • OM
  • ONCM
  • Oncomodulin
  • Parvalbumin beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01134
Species: Hu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB6967
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
557-NT/CF
Species: Rt
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP2-14568
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Oncomodulin Antibody (NBP2-14568) (0)

There are no publications for Oncomodulin Antibody (NBP2-14568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Oncomodulin Antibody (NBP2-14568) (0)

There are no reviews for Oncomodulin Antibody (NBP2-14568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Oncomodulin Antibody (NBP2-14568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Oncomodulin Products

Bioinformatics Tool for Oncomodulin Antibody (NBP2-14568)

Discover related pathways, diseases and genes to Oncomodulin Antibody (NBP2-14568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Oncomodulin Antibody (NBP2-14568)

Discover more about diseases related to Oncomodulin Antibody (NBP2-14568).
 

Pathways for Oncomodulin Antibody (NBP2-14568)

View related products by pathway.

PTMs for Oncomodulin Antibody (NBP2-14568)

Learn more about PTMs related to Oncomodulin Antibody (NBP2-14568).

Blogs on Oncomodulin

There are no specific blogs for Oncomodulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Oncomodulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OCM
Entrez