OMgp Recombinant Protein Antigen (NBP1-82484PEP)

Images

 
There are currently no images for OMgp Protein (NBP1-82484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OMgp Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OMG.

Source: E.coli

Amino Acid Sequence: VDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVANAWKVNA

Protein/Peptide Type
Recombinant Protein Antigen
Gene
OMG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82484.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OMgp Recombinant Protein Antigen

  • oligodendrocyte myelin glycoprotein
  • OMG
  • OMgp
  • OMGPoligodendrocyte-myelin glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2439
Species: Mu
Applications: WB, IHC
AF1440
Species: Mu
Applications: WB
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF3086
Species: Hu
Applications: WB, IHC
NB120-12126
Species: Hu, Mu
Applications: WB
AF3086
Species: Hu
Applications: WB, IHC

Publications for OMgp Protein (NBP1-82484PEP) (0)

There are no publications for OMgp Protein (NBP1-82484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OMgp Protein (NBP1-82484PEP) (0)

There are no reviews for OMgp Protein (NBP1-82484PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for OMgp Protein (NBP1-82484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OMgp Products

OMgp NBP1-82484PEP

Related Products by Gene

Bioinformatics Tool for OMgp Protein (NBP1-82484PEP)

Discover related pathways, diseases and genes to OMgp Protein (NBP1-82484PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OMgp Protein (NBP1-82484PEP)

Discover more about diseases related to OMgp Protein (NBP1-82484PEP).
 

Pathways for OMgp Protein (NBP1-82484PEP)

View related products by pathway.

PTMs for OMgp Protein (NBP1-82484PEP)

Learn more about PTMs related to OMgp Protein (NBP1-82484PEP).

Blogs on OMgp

There are no specific blogs for OMgp, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KHSRP Antibody
NBP1-18910
KHSRP Antibody
NBP1-18910
KHSRP Antibody
NBP1-18910
Nogo Antibody
NB100-56681
Nogo Antibody
NB100-56681
Nogo Antibody
NB100-56681

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OMgp Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OMG
Entrez