Olfactomedin-2/Noelin-2 Antibody


Immunocytochemistry/ Immunofluorescence: Olfactomedin-2/Noelin-2 Antibody [NBP2-56884] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

Olfactomedin-2/Noelin-2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLFYNKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDES
Specificity of human Olfactomedin-2/Noelin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Olfactomedin-2/Noelin-2 Antibody

  • neuronal olfactomedin related ER localized protein 2
  • NOE2
  • NOE2noelin 2
  • Noelin-2
  • NOELIN2_V1
  • olfactomedin 2
  • Olfactomedin2
  • Olfactomedin-2
  • OlfC
  • OLFM2
  • OM2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, Single Cell Western
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Sh
Applications: WB
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884) (0)

There are no publications for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884) (0)

There are no reviews for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Olfactomedin-2/Noelin-2 Products

Bioinformatics Tool for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884)

Discover related pathways, diseases and genes to Olfactomedin-2/Noelin-2 Antibody (NBP2-56884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884)

Discover more about diseases related to Olfactomedin-2/Noelin-2 Antibody (NBP2-56884).

Pathways for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884)

View related products by pathway.

PTMs for Olfactomedin-2/Noelin-2 Antibody (NBP2-56884)

Learn more about PTMs related to Olfactomedin-2/Noelin-2 Antibody (NBP2-56884).

Blogs on Olfactomedin-2/Noelin-2

There are no specific blogs for Olfactomedin-2/Noelin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Olfactomedin-2/Noelin-2 Antibody and receive a gift card or discount.


Gene Symbol OLFM2