Olfactomedin-1/Noelin-1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Olfactomedin-1/Noelin-1 Antibody [NBP2-33836] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Olfactomedin-1/Noelin-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Olfactomedin-1/Noelin-1 Antibody - BSA Free (NBP2-33836) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDE
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OLFM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Olfactomedin-1/Noelin-1 Antibody - BSA Free

• AMY
• AMYolfactomedin related ER localized protein
• neuroblastoma protein
• Neuronal olfactomedin-related ER localized protein
• NOE1
• NOE1noelin
• NOEL1
• NOELIN
• NOELIN1
• Noelin-1
• OlfA
• olfactomedin 1
• Olfactomedin1
• Olfactomedin-1
• OLFM1
• pancortin 1

Background

Noelin product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OLFM1
• Uniprot:
  • Q99784(Human)