Salivary Amylase Beta Antibody

Images

 
Western Blot: Salivary Amylase Beta Antibody [H00000277-B01P] - Analysis of AMY1B expression in human pancreas.
Western Blot: Salivary Amylase Beta Antibody [H00000277-B01P] - Analysis of AMY1B expression in transfected 293T cell line by AMY1B polyclonal antibody. Lane 1: AMY1B transfected lysate(56.21 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Salivary Amylase Beta Antibody Summary

Immunogen
AMY1B (NP_001008219.1, 1 a.a. - 511 a.a.) full-length human protein. MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
AMY1B
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Salivary Amylase Beta Antibody

  • alpha-amylase 1
  • AMY1
  • AMY1A
  • AMY1C
  • amylase, alpha 1B (salivary)
  • amylase, alpha 1B; salivary
  • amylase, salivary, alpha-1B
  • EC 3.2.1.1
  • glycogenase
  • MGC177995,1,4-alpha-D-glucan glucanohydrolase 1
  • Salivary alpha-amylase
  • salivary amylase alpha 1B

Background

Used for the structural analysis of starch and glycogen. Beta-amylase is found in the seeds of higher plants and in sweet potatoes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45492
Species: Hu
Applications: WB, IHC
AF4317
Species: Hu
Applications: WB
AF4636
Species: Mu
Applications: WB
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-89101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7570-GH
Species: Hu
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000277-B01P
Species: Hu
Applications: WB

Publications for Salivary Amylase Beta Antibody (H00000277-B01P) (0)

There are no publications for Salivary Amylase Beta Antibody (H00000277-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Salivary Amylase Beta Antibody (H00000277-B01P) (0)

There are no reviews for Salivary Amylase Beta Antibody (H00000277-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Salivary Amylase Beta Antibody (H00000277-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Salivary Amylase Beta Products

Salivary Amylase Beta H00000277-B01P

Bioinformatics Tool for Salivary Amylase Beta Antibody (H00000277-B01P)

Discover related pathways, diseases and genes to Salivary Amylase Beta Antibody (H00000277-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Salivary Amylase Beta Antibody (H00000277-B01P)

Discover more about diseases related to Salivary Amylase Beta Antibody (H00000277-B01P).

Blogs on Salivary Amylase Beta

There are no specific blogs for Salivary Amylase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Salivary Amylase Beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMY1B
Uniprot