ODF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ODF2 Antibody [NBP2-58793] - Staining of human cell line U-2 OS shows localization to centrosome. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ODF2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDG
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ODF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ODF2 Recombinant Protein Antigen (NBP2-58793PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ODF2 Antibody

  • Cenexin
  • FLJ44866
  • MGC111096
  • MGC9034
  • ODF2/1
  • ODF2/2
  • ODF8484-kD
  • outer dense fiber of sperm tails 2
  • outer dense fiber protein 2
  • sperm tail structural protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93601
Species: Hu, Mu, Rt
Applications: WB
NBP2-38937
Species: Hu
Applications: IHC, IHC-P
462-TR/CF
Species: Mu
Applications: BA
NB100-74638
Species: Hu
Applications: ICC/IF, IP, WB (-)
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-88795
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12440
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-90614
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31979
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF2030
Species: Hu
Applications: IHC, WB
NBP1-87947
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14040
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-17139
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
NBP1-90363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-58793
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ODF2 Antibody (NBP2-58793) (0)

There are no publications for ODF2 Antibody (NBP2-58793).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODF2 Antibody (NBP2-58793) (0)

There are no reviews for ODF2 Antibody (NBP2-58793). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ODF2 Antibody (NBP2-58793) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ODF2 Products

Array NBP2-58793

Bioinformatics Tool for ODF2 Antibody (NBP2-58793)

Discover related pathways, diseases and genes to ODF2 Antibody (NBP2-58793). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODF2 Antibody (NBP2-58793)

Discover more about diseases related to ODF2 Antibody (NBP2-58793).
 

Pathways for ODF2 Antibody (NBP2-58793)

View related products by pathway.

PTMs for ODF2 Antibody (NBP2-58793)

Learn more about PTMs related to ODF2 Antibody (NBP2-58793).

Blogs on ODF2

There are no specific blogs for ODF2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ODF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ODF2