ODF2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ODF2 Antibody [NBP1-85417] - Staining in human testis and prostate tissues using anti-ODF2 antibody. Corresponding ODF2 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: ODF2 Antibody [NBP1-85417] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: ODF2 Antibody [NBP1-85417] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ODF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
Specificity
Specificity of human ODF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ODF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ICC/IF reported in scientific literature (PMID: 24046448). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publications using
NBP1-85417 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24046448).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ODF2 Antibody

  • Cenexin
  • FLJ44866
  • MGC111096
  • MGC9034
  • ODF2/1
  • ODF2/2
  • ODF8484-kD
  • outer dense fiber of sperm tails 2
  • outer dense fiber protein 2
  • sperm tail structural protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38050
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00006676-Q01
Species: Hu
NB100-74638
Species: Hu
Applications: WB (-), ICC/IF, IP
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-43333
Species: Mu
Applications: WB
NBP1-90614
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-87947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
H00146852-P01
Species: Hu
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ODF2 Antibody (NBP1-85417)(3)

Reviews for ODF2 Antibody (NBP1-85417) (0)

There are no reviews for ODF2 Antibody (NBP1-85417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ODF2 Antibody (NBP1-85417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ODF2 Products

Bioinformatics Tool for ODF2 Antibody (NBP1-85417)

Discover related pathways, diseases and genes to ODF2 Antibody (NBP1-85417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODF2 Antibody (NBP1-85417)

Discover more about diseases related to ODF2 Antibody (NBP1-85417).
 

Pathways for ODF2 Antibody (NBP1-85417)

View related products by pathway.

PTMs for ODF2 Antibody (NBP1-85417)

Learn more about PTMs related to ODF2 Antibody (NBP1-85417).

Blogs on ODF2

There are no specific blogs for ODF2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ODF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ODF2