OCT6 Antibody

Images

 
Immunohistochemistry-Paraffin: OCT6 Antibody [NBP3-10963] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human small intestine tissue.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OCT6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat OCT6 (NP_620193). Peptide sequence CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD
Clonality
Polyclonal
Host
Rabbit
Gene
POU3F1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Immunohistochemistry-Paraffin
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for OCT6 Antibody

  • Oct-6
  • OCT6POU domain transcription factor SCIP
  • Octamer-binding protein 6
  • Octamer-binding transcription factor 6
  • OTF6
  • OTF-6
  • POU class 3 homeobox 1
  • POU domain class 3, transcription factor 1
  • POU domain, class 3, transcription factor 1
  • SCIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2864
Species: Hu
Applications: WB, IHC, ICC
NBP2-21585
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-49872
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89934
Species: Hu
Applications: WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP3-10963
Species: Hu, Rt
Applications: WB, IHC-P

Publications for OCT6 Antibody (NBP3-10963) (0)

There are no publications for OCT6 Antibody (NBP3-10963).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCT6 Antibody (NBP3-10963) (0)

There are no reviews for OCT6 Antibody (NBP3-10963). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCT6 Antibody (NBP3-10963) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OCT6 Products

Bioinformatics Tool for OCT6 Antibody (NBP3-10963)

Discover related pathways, diseases and genes to OCT6 Antibody (NBP3-10963). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCT6 Antibody (NBP3-10963)

Discover more about diseases related to OCT6 Antibody (NBP3-10963).
 

Pathways for OCT6 Antibody (NBP3-10963)

View related products by pathway.

PTMs for OCT6 Antibody (NBP3-10963)

Learn more about PTMs related to OCT6 Antibody (NBP3-10963).
 

Research Areas for OCT6 Antibody (NBP3-10963)

Find related products by research area.

Blogs on OCT6

There are no specific blogs for OCT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POU3F1