OCT6 Antibody

Immunocytochemistry/Immunofluorescence: OCT6 Antibody [NBP2-58020] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

OCT6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAG
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU3F1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OCT6 Recombinant Protein Antigen (NBP2-58020PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OCT6 Antibody

• Oct-6
• OCT6POU domain transcription factor SCIP
• Octamer-binding protein 6
• Octamer-binding transcription factor 6
• OTF6
• OTF-6
• POU class 3 homeobox 1
• POU domain class 3, transcription factor 1
• POU domain, class 3, transcription factor 1
• SCIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU3F1