OAT Recombinant Protein Antigen

Images

 
Antibody Competition: OAT Recombinant Protein Antigen [NBP1-83239PEP]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OAT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OAT.

Source: E.coli

Amino Acid Sequence: ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83239. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for OAT Recombinant Protein Antigen

  • GACR
  • HOGA
  • OAT ornithine aminotransferase
  • OATASE
  • OKT

Background

OAT, also known as mitochondrial enzyme ornithine aminotransferase, is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. ( L-ornithine + a 2-oxo acid = L-glutamate 5-semialdehyde + an L-amino acid.) Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Recombinant OAT protein was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-62690
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
MAB6967
Species: Hu
Applications: WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-42202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NBP1-87408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82493
Species: Hu
Applications: IHC, IHC-P, WB

Publications for OAT Recombinant Protein Antigen (NBP1-83239PEP) (0)

There are no publications for OAT Recombinant Protein Antigen (NBP1-83239PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAT Recombinant Protein Antigen (NBP1-83239PEP) (0)

There are no reviews for OAT Recombinant Protein Antigen (NBP1-83239PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OAT Recombinant Protein Antigen (NBP1-83239PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OAT Products

Array NBP1-83239PEP

Bioinformatics Tool for OAT Recombinant Protein Antigen (NBP1-83239PEP)

Discover related pathways, diseases and genes to OAT Recombinant Protein Antigen (NBP1-83239PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OAT Recombinant Protein Antigen (NBP1-83239PEP)

Discover more about diseases related to OAT Recombinant Protein Antigen (NBP1-83239PEP).
 

Pathways for OAT Recombinant Protein Antigen (NBP1-83239PEP)

View related products by pathway.

PTMs for OAT Recombinant Protein Antigen (NBP1-83239PEP)

Learn more about PTMs related to OAT Recombinant Protein Antigen (NBP1-83239PEP).

Blogs on OAT

There are no specific blogs for OAT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OAT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OAT