OAS2 Antibody - BSA Free

Western Blot: OAS2 Antibody [NBP1-58951] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OAS2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to OAS2(2'-5'-oligoadenylate synthetase 2, 69/71kDa) The peptide sequence was selected from the N terminal of OAS2. Peptide sequence DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OAS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OAS2 Antibody - BSA Free

• (2-5')oligo(A) synthase 2
• (2'-5')oligo(A) synthetase 2
• (2-5')oligo(A) synthetase 2
• 2'5' oligoadenylate synthetase 2
• 2-5A synthase 2
• 2-5A synthetase 2
• 2'-5'-oligoadenylate synthase 2
• 2'-5'-oligoadenylate synthetase 2 (69-71 kD)
• 2'-5'-oligoadenylate synthetase 2, 69/71kDa
• EC 2.7.7
• EC 2.7.7.-
• MGC78578
• OAS2
• p69 OAS / p71 OAS
• p69OAS / p71OAS

Background

OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OAS2
• Uniprot:
  • P29728-2(Human)