O-GlcNAc Transferase p110 subunit Antibody

Images

 
Independent Antibodies: Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252] - Analysis using Anti-OGT antibody NBP2-55252 (A) shows similar pattern to independent antibody NBP1-89845 (B).
Immunocytochemistry/ Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

O-GlcNAc Transferase p110 subunit Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRL
Specificity
Specificity of human O-GlcNAc Transferase p110 subunit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OGT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-55252PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for O-GlcNAc Transferase p110 subunit Antibody

  • EC 2.4.1
  • EC 2.4.1.255
  • FLJ23071
  • HRNT1
  • MGC22921
  • O-GlcNAc transferase p110 subunit
  • O-GlcNAc transferase subunit p110
  • OGlcNAc Transferase
  • O-GlcNAc Transferase
  • O-GLCNAC
  • OGT
  • O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
  • O-linked N-acetylglucosamine transferase 110 kDa subunit
  • UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit
  • uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-02056
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
NB100-68209
Species: Hu
Applications: WB, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2200
Species: Hu
Applications: WB, IP
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-04382
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-14977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252) (0)

There are no publications for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252) (0)

There are no reviews for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional O-GlcNAc Transferase p110 subunit Products

Bioinformatics Tool for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252)

Discover related pathways, diseases and genes to O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252)

Discover more about diseases related to O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252).
 

Pathways for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252)

View related products by pathway.

PTMs for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252)

Learn more about PTMs related to O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252).
 

Research Areas for O-GlcNAc Transferase p110 subunit Antibody (NBP2-55252)

Find related products by research area.

Blogs on O-GlcNAc Transferase p110 subunit

There are no specific blogs for O-GlcNAc Transferase p110 subunit, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our O-GlcNAc Transferase p110 subunit Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OGT