NXF5 Antibody

Western Blot: NXF5 Antibody [NBP1-57260] - Lanes: Lane 1 : 7ug HeLa cystosolic extract Lane 2: 7ug HeLa nuclear extract Primary, Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF5.

Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: NXF5 Antibody [NBP1-57260] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml

Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NXF5 Antibody Summary

• Immunogen: Synthetic peptides corresponding to NXF5 (nuclear RNA export factor 5) The peptide sequence was selected from the middle region of NXF5. Peptide sequence ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NXF5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against NXF5 and was validated on Western Blot and immunohistochemistry-p

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NXF5 Antibody

• nuclear RNA export factor 5
• TAPL1
• TAPL-1
• TAP-like protein 1

Background

NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NXF5
• Uniprot:
  • Q9H1B4(Human)