NUT Antibody


Immunohistochemistry-Paraffin: NUT Antibody [NBP1-84176] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: NUT Antibody [NBP1-84176] - Staining of human endometrium shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NUT Antibody [NBP1-84176] - Staining in human testis and endometrium tissues using anti-NUTM1 antibody. Corresponding NUTM1 RNA-seq data are presented for the more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

NUT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSA
Specificity of human NUT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUT Protein (NBP1-84176PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NUT Antibody

  • C15orf55
  • chromosome 15 open reading frame 55
  • DKFZp434O192
  • FAM22H
  • MGC138683
  • MGC138684
  • Nuclear protein in testis
  • NUT
  • protein NUT


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Dr
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for NUT Antibody (NBP1-84176) (0)

There are no publications for NUT Antibody (NBP1-84176).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUT Antibody (NBP1-84176) (0)

There are no reviews for NUT Antibody (NBP1-84176). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NUT Antibody (NBP1-84176) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUT Products

NUT NBP1-84176

Bioinformatics Tool for NUT Antibody (NBP1-84176)

Discover related pathways, diseases and genes to NUT Antibody (NBP1-84176). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUT Antibody (NBP1-84176)

Discover more about diseases related to NUT Antibody (NBP1-84176).

Pathways for NUT Antibody (NBP1-84176)

View related products by pathway.

Blogs on NUT.

Understanding the relationship between NUT and BET proteins in NMC
NUT has been found to fuse with bromodomain-containing proteins 3 and 4 (BRD3 and BRD4) in NUT midline carcinoma (NMC), a very rare, extremely aggressive, and genetically defined human cancer. NMC has recently been designated as a sub classificati...  Read full blog post.

NUT - A Protein Coding Gene
The NUT gene is found on chromosome 15q14 and encodes for the NUT protein which is a key component of the RNA polymerase II Mediator complex. This multi-subunit assembly is required for all RNA pol II-dependent transcriptional activation, coordinating...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUT Antibody and receive a gift card or discount.


Gene Symbol NUTM1