NUPL2 Antibody

Product Discontinued

NUPL2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQPSSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKEGFGLSENPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUP42
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control:

  A-431 Whole Cell Lysate
  Human Thyroid Whole Tissue Lysate (Adult Whole Normal)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NUPL2 Antibody

• CG1NUP42 homolog
• H_RG271G13.9
• hCG1
• NLP_1
• NLP-1
• Nucleoporin hCG1
• nucleoporin like 2
• nucleoporin-like protein 1
• nucleoporin-like protein 2

Background

NUPL2 is required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. In case of infection by HIV-1, it may participate in the docking of viral Vpr at the nuclear envelope

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUP42
• Uniprot:
  • O15504(Human)