NUP37 Antibody

Images

 
Independent Antibodies: Western Blot: NUP37 Antibody [NBP2-58005] - Analysis using Anti-NUP37 antibody NBP2-58005 (A) shows similar pattern to independent antibody NBP2-55454 (B).
Orthogonal Strategies: Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining in human lymph node and skeletal muscle tissues using anti-NUP37 antibody. Corresponding NUP37 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUP37 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQ
Specificity
Specificity of human NUP37 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUP37
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUP37 Recombinant Protein Antigen (NBP2-58005PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NUP37 Antibody

  • MGC5585
  • nucleoporin 37kDa
  • nucleoporin Nup37
  • Nup107-160 subcomplex subunit Nup37
  • p37FLJ22618

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
409-ML/CF
Species: Mu
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
AF3928
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-23485
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
AF2428
Species: Hu
Applications: WB
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92564
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7918
Species: Hu
Applications: WB, Simple Western
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP

Publications for NUP37 Antibody (NBP2-58005) (0)

There are no publications for NUP37 Antibody (NBP2-58005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUP37 Antibody (NBP2-58005) (0)

There are no reviews for NUP37 Antibody (NBP2-58005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUP37 Antibody (NBP2-58005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NUP37 Products

Bioinformatics Tool for NUP37 Antibody (NBP2-58005)

Discover related pathways, diseases and genes to NUP37 Antibody (NBP2-58005). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUP37 Antibody (NBP2-58005)

Discover more about diseases related to NUP37 Antibody (NBP2-58005).
 

Pathways for NUP37 Antibody (NBP2-58005)

View related products by pathway.

Blogs on NUP37

There are no specific blogs for NUP37, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUP37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP37