Nup153 Recombinant Protein Antigen

Images

 
There are currently no images for Nup153 Protein (NBP1-81723PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nup153 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUP153.

Source: E. coli

Amino Acid Sequence: SSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NUP153
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81723.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nup153 Recombinant Protein Antigen

  • CG4453
  • dmNup153
  • dNup153
  • HNUP153
  • N153
  • nuclear pore complex protein hnup153,153 kDa nucleoporin
  • nuclear pore complex protein Nup153
  • nucleoporin 153kD
  • nucleoporin 153kDa
  • Nucleoporin Nup153
  • Nup 153
  • Nup153 Nucleoporin 153
  • nup153

Background

Nuclear pore complexes are extremely elaborate structures that mediate the regulated movement of macromolecules between the nucleus and cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are pore complex specific glycoproteins characterized by cytoplasmically oriented O linked N acetylglucosamine residues and numerous repeats of the pentapeptide sequence XFXFG. Nup153 has three distinct domains: a N terminal region within which a pore targeting domain has been identified, a central region containing multiple zinc finger motifs, and a C terminal region containing multiple XFXFG repeats. Nup153 is a possible DNA binding subunit of the nuclear pore complex (NPC). The repeat containing domain may be involved in anchoring components of the pore complex to the pore membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NB100-2244
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-83213
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76926
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-93336
Species: Hu
Applications: IP, WB
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-81723PEP
Species: Hu
Applications: AC

Publications for Nup153 Protein (NBP1-81723PEP) (0)

There are no publications for Nup153 Protein (NBP1-81723PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nup153 Protein (NBP1-81723PEP) (0)

There are no reviews for Nup153 Protein (NBP1-81723PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nup153 Protein (NBP1-81723PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nup153 Products

Array NBP1-81723PEP

Research Areas for Nup153 Protein (NBP1-81723PEP)

Find related products by research area.

Blogs on Nup153.

NUP153 & 53BP1: A Novel DNA Repair Pathway
Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De...  Read full blog post.

Customers Who Bought This Also Bought

Nup153 Antibody
NB100-93329

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nup153 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP153