NUDT9 Antibody

Images

 
Immunohistochemistry: NUDT9 Antibody [NBP2-48818] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDT9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUDT9 Recombinant Protein Antigen (NBP2-48818PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUDT9 Antibody

  • ADP-ribose diphosphatase
  • ADP-ribose phosphohydrolase
  • ADP-ribose pyrosphosphatase NUDT9
  • ADPR-PPase
  • EC 3.6.1.13
  • MGC3037
  • mitochondrial
  • nucleoside diphosphate linked moiety X-type motif 9
  • nudix (nucleoside diphosphate linked moiety X)-type motif 9
  • Nudix motif 9
  • NUDT10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DCLU00
Species: Hu
Applications: ELISA
NBP1-28728
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
NBP3-06300
Species: Hu
Applications: ICC/IF, WB
NBP1-83131
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88462
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-87845
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-57403
Species: Hu
Applications: ICC/IF, WB
NBP2-47297
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-48818
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NUDT9 Antibody (NBP2-48818) (0)

There are no publications for NUDT9 Antibody (NBP2-48818).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT9 Antibody (NBP2-48818) (0)

There are no reviews for NUDT9 Antibody (NBP2-48818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NUDT9 Antibody (NBP2-48818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUDT9 Products

Bioinformatics Tool for NUDT9 Antibody (NBP2-48818)

Discover related pathways, diseases and genes to NUDT9 Antibody (NBP2-48818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDT9 Antibody (NBP2-48818)

Discover more about diseases related to NUDT9 Antibody (NBP2-48818).
 

Pathways for NUDT9 Antibody (NBP2-48818)

View related products by pathway.

PTMs for NUDT9 Antibody (NBP2-48818)

Learn more about PTMs related to NUDT9 Antibody (NBP2-48818).

Blogs on NUDT9

There are no specific blogs for NUDT9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT9