GLOD4 Antibody


Western Blot: GLOD4 Antibody [NBP1-88462] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: GLOD4 Antibody [NBP1-88462] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88462] - Staining in human duodenum and skeletal muscle tissues using anti-GLOD4 antibody. Corresponding GLOD4 RNA-seq data are presented for the same tissues.
Western Blot: GLOD4 Antibody [NBP1-88462] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88462] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88462] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88462] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GLOD4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
Specificity of human, mouse, rat GLOD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
GLOD4 Lysate (NBP2-65241)
Control Peptide
GLOD4 Protein (NBP1-88462PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GLOD4 Antibody

  • C17orf25
  • CGI-150
  • chromosome 17 open reading frame 25
  • glyoxalase domain containing 4
  • glyoxalase domain-containing protein 4
  • HC71


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P

Publications for GLOD4 Antibody (NBP1-88462) (0)

There are no publications for GLOD4 Antibody (NBP1-88462).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLOD4 Antibody (NBP1-88462) (0)

There are no reviews for GLOD4 Antibody (NBP1-88462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLOD4 Antibody (NBP1-88462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional GLOD4 Products

Bioinformatics Tool for GLOD4 Antibody (NBP1-88462)

Discover related pathways, diseases and genes to GLOD4 Antibody (NBP1-88462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLOD4 Antibody (NBP1-88462)

Discover more about diseases related to GLOD4 Antibody (NBP1-88462).

Pathways for GLOD4 Antibody (NBP1-88462)

View related products by pathway.

Blogs on GLOD4

There are no specific blogs for GLOD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GLOD4 Antibody and receive a gift card or discount.


Gene Symbol GLOD4