NUDT6 Antibody

Images

 
Immunohistochemistry: NUDT6 Antibody [NBP2-49473] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDT6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HIPILQSRFIAPAASLGFRFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGD
Specificity
Specificity of human NUDT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUDT6 Recombinant Protein Antigen (NBP2-49473PEP)

Reactivity Notes

Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUDT6 Antibody

  • Antisense basic fibroblast growth factor
  • ASFGF2
  • bFGF
  • FGF2ASFGF-2
  • FGF-AS
  • gfg
  • gfg-1
  • nucleoside diphosphate-linked moiety X motif 6
  • nudix (nucleoside diphosphate linked moiety X)-type motif 6
  • Nudix motif 6
  • nudix-type motif 6
  • Protein GFG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2200
Species: Hu
Applications: WB, IP
NBP1-31702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-58294
Species: Hu
Applications: IHC, IHC-P
AF7548
Species: Hu
Applications: IHC
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-49473
Species: Hu
Applications: IHC, IHC-P

Publications for NUDT6 Antibody (NBP2-49473) (0)

There are no publications for NUDT6 Antibody (NBP2-49473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT6 Antibody (NBP2-49473) (0)

There are no reviews for NUDT6 Antibody (NBP2-49473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NUDT6 Antibody (NBP2-49473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NUDT6 Antibody (NBP2-49473)

Discover related pathways, diseases and genes to NUDT6 Antibody (NBP2-49473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDT6 Antibody (NBP2-49473)

Discover more about diseases related to NUDT6 Antibody (NBP2-49473).
 

Pathways for NUDT6 Antibody (NBP2-49473)

View related products by pathway.

PTMs for NUDT6 Antibody (NBP2-49473)

Learn more about PTMs related to NUDT6 Antibody (NBP2-49473).

Blogs on NUDT6

There are no specific blogs for NUDT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT6